Protein Model on 4dba_D_1_H_1 (TEMPLATE: 4dba )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [196 aa] Designed Armadillo repeat protein, YIIM3AII
2 b H 1 (D) non-polymer(GOL) GLYCEROL 399W (identity: 100.0 %/38.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4dba_D_1 identity=38.1%
queryA       295:VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQ: 394
                : **    *          * *    *     ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **       :
4dba_D_1      14:LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQIL: 113
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHH:    
ExpBur          :eeebeebeeeeeeeeeeebeeebeeeeeeeeeeeeeebeeeebeeebeebebeeeeebeebbeebbebbeeeeebbeebbebebbeebbebbeeeeeebb:    

queryA       395:KEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEK: 494
                : ** **  *  ***  ***      *    *  **      *    * * ***       *   *      * * * * * ** ****   *      **:
4dba_D_1     114:QEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGALEKLEQLQSHENEKIQKEAQEALEK: 206
SecStr          :HHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHTTS S HHHHHHHHHHHHHHHTS---- HHHHHHH--HTTTHHHHHHHTTT SSHHHHHHHHHHHHH:    
ExpBur          :eebbebbbbbbebbe-ebbeebbeeebbeebbebbebeeeebbeebbebbbbbbeb----eeebeeeb--eeeebeeebeebeebeeeebeebbeebbee:    
Contact         :    b                                                                                               

queryA       495:Y: 495
                : :
4dba_D_1     207:L: 207
SecStr          :H:    
ExpBur          :b:    


Input Residue Numbers for Focused Sites

ex) 2,15,123