Protein Model on 4djs_A_1_B_1 (TEMPLATE: 4djs )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [507 aa] Catenin beta-1 :CTNB1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [15 aa] stapled peptide RRWPQ(MK8)ILD(MK8)HVRRVWR 132D(N) 134S(K) 135P(F) 138F(I) 141A(D) 181Q(K) 184W (identity: 14.3 %/27.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4djs_A_1 identity=27.9%
queryA       118:AGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVF---RDLVIKYGAVDPLLALLA: 214
                :**   * *  *  *            *   * *  *        *   *             *   *         **           *    *   * :
4djs_A_1     129:AGGLQKMVALLNKTNVKFLAITTD-CLQILAYGNQESKLIILASGGPQALVNIMRT---YTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLT: 224
SecStr          :TTHHHHHHHGGG   HHHHHHHHH-HHHHHHTT HHHHHHHHHTTHHHHHHHHHTT---   HHHHHHHHHHHHHHHTSTTHHHHHHHTTHHHHHGGGSS:    
ExpBur          :eebbeebbebbeeeeeebbbebbb-bbbbbbeeeeebbeebeeeebbebbbebbee---eeeeebbebbbebbebbbebeebbeebbebbbbbbbbebbe:    
Contact         :              b bb  b  b                                       b  b                                 

queryA       215:VPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVK--LLGASELPIVTP: 312
                : *           *  *** **      *      *  * *** **  **  *        * **        **   *    **   *       *  *:
4djs_A_1     225:DPSQR-----LVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEP: 316
SecStr          :SS HH-----HHHHHHHHHHHH---TTT  S SS HHHHHHHHHHTT S HHHHHHHHHHHHHHTTT HHHHHHHHHTTHHHHHHHHHHHHTT HHHHHH:    
ExpBur          :eebee-----bbbbbbebbeeb---beebeeeeebeebbebbbebbeeeeeebbbbbbbbbbebbeebeebbbbbbeeebbebbbebbeebeeebebbeb:    

queryA       313:ALRAIGNIVTGTDE----QTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV-VNH------GLVPFLVSVLSKADFKTQK: 395
                :*  *         *    *  *    * * *   **  *         *     * *          **      *  * **  *  *   ** :
4djs_A_1     317:AICALRHLTSRHQEAEMAQNAVRLHYG-LPVVVKLLHPP-------SHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQR: 402
SecStr          :HHHHHHHHTSSSTTHHHHHHHHHHTT -HHHHHHTTSSS-------  HHHHHHHHHHHHHHHSSGGGHHHHHHTTTTHHHHHHHHHHHHHHH :    
ExpBur          :bbbbbebbbbebeebeebbbbbeeeeb-bebbbebbeee-------bebebbebbbbbbebbbebeebbeebeeeebbebbbebbeebbeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123