Protein Model on 4e4v_B_1_N_1 (TEMPLATE: 4e4v )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [433 aa] Importin subunit alpha-2 :IMA2_HUMAN
2 b N 1 (B) non-polymer(GOL) GLYCEROL 353K 354E 357W 396E (identity: 100.0 %/99.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4e4v_B_1 identity=99.8%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :****************************************************************************************************:
4e4v_B_1      26:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 125
SecStr          :S   TT  HHHHHHHHT S HHHHHHHHHHHHHHHH SSS  HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :ebbbeebeeeebbebbeeeeeeebbbbbbbbbbbbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbe:    

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :****************************************************************************************************:
4e4v_B_1     126:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 225
SecStr          :HTT SSHHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT   HHHHH:    
ExpBur          :bbebeeeebbebbbebbbebbeeebebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeebbeeebbeebbebbeebbebebeebbb:    

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :****************************************************************************************************:
4e4v_B_1     226:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 325
SecStr          :HHHHHHHHHTSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHH:    
ExpBur          :bbbebbbbbbeeeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbebebbeebeebbebeeeebeebbbebbbebbebeeeb:    
Contact         :                                                                                   bb  b            

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :****************************************************************************************************:
4e4v_B_1     326:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 425
SecStr          :HHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeebeeebbeebbebbbbbbeebeeebbeebbebebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeebb:    
Contact         :                          b                                                                         

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :**************** ***********:
4e4v_B_1     426:LDKIEALQNHENESVYRASLSLIEKYFS: 453
SecStr          :HHHHHGGG TT HHHHHHHHHHHHHH  :    
ExpBur          :beebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123