Protein Model on 4htv_A_1_B_1 (TEMPLATE: 4htv )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [427 aa] Importin subunit alpha-2 :IMA2_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [7 aa] capsid protein :Q68SX0_BFDV 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4htv_A_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
4htv_A_1      52:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 151
SecStr          :   SS  HHHHHHHHHSS HHHHHHHHHHHHHHTT SS   HHHHHHTT HHHHHHHTT SS HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHH:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbbbbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbeebbeb:    
Contact         :                                  bbb  b                           b   b   b bbbbb  b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
4htv_A_1     152:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 251
SecStr          :HT S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHT  S GGGS HHHHHHHHHHHHHHH   TT   HHHHHHHHHHHHHHTTSS HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbe:    
Contact         :          b  b   b  bb                                   b  b   b  b                                

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
4htv_A_1     252:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 351
SecStr          :HHHHHHHHTSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeebb:    
Contact         :  b   b                                                                                             

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
4htv_A_1     352:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 451
SecStr          :HHHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHGGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebebb:    

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                :******* *********** *******:
4htv_A_1     452:DKIEALQRHENESVYKASLNLIEKYFS: 478
SecStr          :HHHHTGGGSS HHHHHHHHHHHHHHH :    
ExpBur          :eebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123