Protein Model on 4hxt_A_1_A_2 (TEMPLATE: 4hxt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [247 aa] De Novo Protein OR329
2 b A 2 (A) polymer(polypeptide(L)) [247 aa] De Novo Protein OR329 213L(K) 216P(V) 217D 283N(D) 284E 285R(A) 287G(K) 324T(P) 325D 326E 364A(S) 365G 366R(P) 406S 408G 409T(W) 410V(L) 412Q(H) (identity: 38.9 %/37.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4hxt_A_1 identity=37.3%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                :  * *  *  ** *  * * *  *  ****     ** ** *       ** *        *  ** ***                 *  *  *  *   :
4hxt_A_1       4:VEKLVKLLTSTD-SETQKEAARDLAEIASGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASG---------------PDEAIKAIVDAGG:  87
SecStr          :HHHHHHHTT S -HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS--------------- HHHHHHHHHTTH:    
ExpBur          :beebbeebeeee-eeebbebbeebbeebeeeeebbeebeebebbeebbebbebeeeebbebbbebbbbbbee---------------eeebbebbeeeeb:    
Contact         :                                                                                            b  bb   

queryA       221:LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI: 320
                :                                   ** **   * **      *      ** * *   *  * *  *****          * **  **:
4hxt_A_1      88:V--------------------------------EVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANI: 155
SecStr          :H--------------------------------HHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHH:    
ExpBur          :b--------------------------------ebbbebbebeeeebbbbbbbbbbbbbebeeebbebbbeeebbeebbebbebeeeebbbbbbbbbbbb:    
Contact         :                                                              bbb b                                 

queryA       321:VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQ: 412
                :  * **      ***   *   ***      ****     **  *    *   *  * *  *   *   *   ****  *  *  ***  * :
4hxt_A_1     156:ASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAGGVEVLQKLLTSTDSEVQKEAQRALENIKSGGWLEH: 247
SecStr          :TTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTSBHHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHHHT B   :    
ExpBur          :beeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebbeebbebbeeeebeeebeebeebeeeebeebbeebeeebeeebeeee:    
Contact         :   bbb                                     bbb                                       b bbb b        


Input Residue Numbers for Focused Sites

ex) 2,15,123