Protein Model on 4plr_A_1_B_1 (TEMPLATE: 4plr )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [289 aa] Arm00008
2 b B 1 (B) polymer(polypeptide(L)) [289 aa] Arm00008 142W 149S 150G 151T(G) 180E(Q) 184W 191G(S) 219S(Q) 227R(Q) 228N(E) 231W 273W 277Y(N) 311T(Q) 315R(W) 350N(K) (identity: 37.5 %/39.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4plr_A_1 identity=39.5%
queryA       112:IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLA: 211
                :*   * **  *  *  *        * *  * * *****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  :
4plr_A_1      44:IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQ: 142
SecStr          :HHHHHHTTHHHHHHHHTT S HHHHH-HHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :beebbeeebbebbbebbeeeeeebbe-ebbebbbbbbebbeebbbebbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbebbbeeebbeebbe:    
Contact         :                              b      bbb                            b   b      b                    

queryA       212:LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI: 309
                :**  *         *    *** *     *    * **     ** ** **       *    *       * ** *  *   *  * ** **      *:
4plr_A_1     143:LLSSPNEQ-----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 235
SecStr          :GGG S HH-----HHHHHHHHHHHHTTS HHH--HHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :bbeeeeee-----bbebbbebbbbbbebbeeb--bbbbbeeebbebbbebbeeeeeebbbbbbebbbebbebeeebbbbbbeeebbebbbebbebeeeeb:    
Contact         :       b       bb  b                                           b   b                                

queryA       310:VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI: 362
                :   **   ***  *  ** * *  ***      *   *   *****      *:
4plr_A_1     236:LQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKI: 288
SecStr          :HHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHT:    
ExpBur          :bebbbebbbbbbebbeebeebbeeeebeeebeebeebebeebeeebeebbeeb:    
Contact         : b   b                                  b                                                           


Input Residue Numbers for Focused Sites

ex) 2,15,123