Protein Model on 4pls_B_1_J_1 (TEMPLATE: 4pls )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [281 aa] Arm00010
2 b J 1 (B) non-polymer(CA) CALCIUM ION 131T(P) 133C(E) (identity: 0.0 %/39.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4pls_B_1 identity=39.5%
queryA       112:IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLA: 211
                :*   * **  *  *  *        * *  * * *****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  :
4pls_B_1      36:IQAVIDAGALPALVQLLSSPNEQILQ-EALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQ: 134
SecStr          :HHHHHHTTHHHHHHHGGG S HHHHH-HHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :bbeebeeeebeebbeebeeeeeeebe-ebbeebbebbebeeebbbbbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbbbbeeebbeebbe:    
Contact         :                   b b                                                                              

queryA       212:LLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPI: 309
                :**  *         *    *** *     *    * **     ** ** **       *    *       * ** *  *   *  * ** **      *:
4pls_B_1     135:LLSSPNEQ-----ILQEALWTLGNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 227
SecStr          :GGG S HH-----HHHHHHHHHHHHTTS HHH--HHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :bbeeeeee-----bbebbbebbbbbbeeeeeb--bebbbeeebbeebbebbeeeeeebbeebbebbbbbbebeeebbbbbbeeebbebbbebbeeeeeeb:    

queryA       310:VTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNI: 362
                :   **   ***  *  ** * *  ***      *   *   *****      *:
4pls_B_1     228:LQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKI: 280
SecStr          :HHHHHHHHHHHHTS HHHHHHHHTTTHHHHHHTTTS S HHHHHHHHHHHHH :    
ExpBur          :bebbbebbbbbbebeeebeebbeeeebeebbeebeeeeeeebbebbeebeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123