Protein Model on 4pvz_B_1_D_1 (TEMPLATE: 4pvz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [422 aa] Importin subunit alpha :IMA1_YEAST
2 b D 1 (D) polymer(polypeptide(L)) [19 aa] Inner nuclear membrane protein HEH2 :HEH2_YEAST 102K(Q) 104L 105S 106R 107E 110P 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 231W 235N 238R 240K 273W 280D 281G 315R 319N 321V 322T 323G 328T 353K 354E 357W 360S 361N 364A 395K 396E 399W 403N (identity: 97.6 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4pvz_B_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
4pvz_B_1       5:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 104
SecStr          :HHHHHT S HHHHHHHHHHHHHHTSSSS   HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHHHHS HHHHH:    
ExpBur          :bbebbebeeeeebbebbbebbeebeeeeeeebeebbeeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebeb:    
Contact         :                     b bbbb  b                               b   b bbbb   b                         

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
4pvz_B_1     105:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 199
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----G   HHHHHHHHHHHHHHH   SS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbeeebebbbebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbebbebbbebbe:    
Contact         :b  b   b  bb                                      b   b  b b                                b      b

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
4pvz_B_1     200:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 299
SecStr          :SSHHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbebebbebbbebbebebeebbbbbbebbbbbbeeeeebbeebbeeebbebbeebbebeeeebbebbbebbbebbeeebebbeebbeeebbe:    
Contact         :b                                 b   b bbb    b                        bb  b  bb  b                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
4pvz_B_1     300:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 399
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHGGGTT THHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHHHHTT  SS HHHHHHHHTTHHHHH:    
ExpBur          :ebbebbeebeeebbebbbebbbbbbebbeeeeebbeebbeeebbebbbebbeebeeebbbbbbebbbbbbebbeebbeeeeeeebebbeebeebebbebb:    
Contact         :              bb  b   b                                                                             

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
4pvz_B_1     400:FNCQQNENDKIYEKAYKIIETYF: 422
SecStr          :HHGGG S HHHHHHHHHHHHHH :    
ExpBur          :eebbeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123