Protein Model on 4rv1_C_1_H_1 (TEMPLATE: 4rv1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [412 aa] Engineered Protein OR497
2 b H 1 (C) non-polymer(ACT) ACETATE ION 176A(S) 179S(Q) 217D (identity: 33.3 %/36.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rv1_C_1 identity=36.0%
queryA        78:VDDIVKGINSSNVENQLQATQAARKLLSREKQP--PIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH: 175
                :*   **   *   * *     *** *      *   *  *  **     *  *  ** *  * * * ** *****  *  ** ** *       ** *  :
4rv1_C_1      46:VEVLVKLLTSTDSEVQ---KEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD-SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTD: 141
SecStr          :HHHHHHGGG SSHHHH---HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SS-HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG SS:    
ExpBur          :bebbbebbeeeeeebb---ebbbebbbbbbeeeeebbebbeeeebbebbbebbebee-eebbebbbbbbbbbbeeeeebbebbbeeebbebbbebbebee:    

queryA       176:AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQIL-----PTLVRLLHHDDPEVLAD: 270
                :      *  ** ***             * *  *  **   *               * *         *  *   *        ** **   * **   :
4rv1_C_1     142:SEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSE-----VQKEAARALANIASG-----PTSAIKAIVDAGGVEVLVKLLTSTDSEVQKE: 231
SecStr          :HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTT SSHH-----HHHHHHHHHHHHHTS----- HHHHHHHHHTTHHHHHHHHTT S HHHHHH:    
ExpBur          :eebbebbbbbbbbbbebeeebbeebbeeebbeebbebbeeeeee-----bbebbbebbbbbbeb-----eeebbebbeebebbeebbebbeeeeeebbbb:    
Contact         :b  b                                     b                                                          

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                :   *      ** * *   *  * *  *****          * **  **  * **      ***   *   ***      ****     **  *    *:
4rv1_C_1     232:AARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAI: 331
SecStr          :HHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHHTS HHHH:    
ExpBur          :bbbbbbbbbeeeeebbebbbeeebbeebbebbebeeeebbebbbbbbbbbbeeeeebbebbeeeebbeebbebbebeeeebbebbbbbbbbbbebeeebb:    

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI: 436
                :   *  * *  **  *   *   ****  *  *  ** *   *   *  *  * *  ***  *   :
4rv1_C_1     332:KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPT-SAIKAIVDAGGVEVLQKLLTSTDSEV: 396
SecStr          :HHHHTTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHTTT SSHHH:    
ExpBur          :ebbeeeebbebbbebbeeeeeebbebbbbbbbbbbebee-ebbebbeeeebeebbeebeeeeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123