Protein Model on 4rxh_A_1_C_1 (TEMPLATE: 4rxh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [421 aa] Importin subunit alpha :Q9C2K9_NEUCS
2 b C 1 (C) polymer(polypeptide(L)) [8 aa] Large T antigen :LT_SV40 104L 105S 106R(K) 107E 110P 138F 142W 146N 148A 149S 150G 151T(S) 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 270D 273W (identity: 91.7 %/50.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rxh_A_1 identity=50.7%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                : * *  **    * ***   ***** *  ***   *  *    ** ** *      *** **********   **  *   ** * *  ** **     *:
4rxh_A_1      33:MVEGVFSSEIDKQIQATTKFRKLLSKERNPPIEEVIKTGVVGRFVEFL-RSPHTLVQFEAAWALTNIASGSATQTQVVIEAGAVPIFVELLGSPEPDVRE: 131
SecStr          :HHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHT-T S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHH:    
ExpBur          :beebbebeeeeebbebbbebbeebeeeeeeebeebbeeebbebbbebb-ebeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeebeb:    
Contact         :                       bbbb  b                           b   b   b bbbb   b                         

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :************    ** *   **  *** **      *     *** ****** ** * * *        ** *  *    * *** * ******* *:
4rxh_A_1     132:QAVWALGNIAGDSPQCRDYVLSCGALRPLLTLLG----DSRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLVYSLDDEVLIDACWAISYLSD: 227
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHHHH----H   HHHHHHHHHHHHHHH   TT   HHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbeeebebbeebbeeebbeebbebbe----eeeeeebeebbbebbbbbbeeeeeebebeebeebbebbbebbeeebeebbeebbebbbebbe:    
Contact         :b  b  bb  bb                                      b   b  b                               b  b       

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :* *  *  *   *    ** **        *****  ****** * **** *  ***    ***   *  * *** ** ******   *** *      *:
4rxh_A_1     228:GSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQSVIDANIIP: 327
SecStr          :S HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbebbbebbbebbebeeebbeebbebebbe:    

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGG--TVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE--------KLGETEKLSIMIEECGGL: 470
                : *   ** ** ** *** **  * ****     ** ***  * * **  **   * *** * **   **    *                   ****** :
4rxh_A_1     328:PLIHLLSHADLKTRKEACWAISNATSGGLQKPDQIRYLVAQGCIKPLCDLLACPDNKIIQVALDGLENILKVGELDKNAAXXXXXSINRYALFIEECGGM: 427
SecStr          :HHHHHHHSS HHHHHHHHHHHHHTTTTTTT THHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHHHT -----   HHHHHHHHTTHH:    
ExpBur          :ebbebbeeeeeebeebbbebbbbbbebbeeeeebbeebbeeebbebbbebbebeeeebbbbbbebbbebbebbeeeeeee-----eebebbeebeeeebe:    

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                : **   *   **  *      ******:
4rxh_A_1     428:EKIHDCQTNANEEIYMKAYNIIEKYFS: 454
SecStr          :HHHHHGGG  SSTTHHHHHHHHHHH  :    
ExpBur          :eebeebeebeeeebeeebeebbeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123