Protein Model on 4rzp_A_1_B_1 (TEMPLATE: 4rzp )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [242 aa] Engineered Protein OR366
2 b B 1 (B) polymer(polypeptide(L)) [242 aa] Engineered Protein OR366 265P(S) 266E(K) 277Y(E) 280D(S) 305S(D) 306E(D) 307L(S) 308P(K) 347P(D) 348K(D) 349T(S) 350N(K) 389A(D) 390D 391F(S) 392K 432K(D) 433D 434T(S) 435K 480E(D) 481N(D) 482E(S) 483S(K) (identity: 16.7 %/33.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rzp_A_1 identity=33.6%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :*  ** ** ***                *    *  *   *    ** **          * **  **  * **    *******     ***      *:
4rzp_A_1       4:LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQ: 103
SecStr          :HHHHHHHHTSS HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTTSS HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTTS  HHHH:    
ExpBur          :beebbeebeeeeeeebeebbeebbeebeeeeebbeebbebebbeebbebbeeebeebbebbbebbbbbbeeeeebbeebbebebbeebbebbeeeeeebb:    
Contact         :            bb          b  b                        bbbb                                      bbbb  

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : **     **  *    * **   *    **  *   * * * **  *  *  **   * *      *  * *  ***  * *       *  **     :
4rzp_A_1     104:QEAARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGND-EAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIAS---: 199
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTTSS HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTTSS HHHHHHHHHHHHHHTT---:    
ExpBur          :ebbbebbbbbbeeeeebbeebbeeebbeebbebbeeeeeebbbbbbebbbbbbeeee-ebbeebbeeebbeebbebbeeeeeebbbbbbbbbbbbbe---:    
Contact         :                                    bbbb                                       bbbb                 

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  * *      *   * * *   *  *    *        *   *:
4rzp_A_1     200:--GNTSAIKQVI-DAGALEKLQELLTHDDSKVQQEAQRALENIKS: 241
SecStr          :--S HHHHHHHH-HTTHHHHHHHHTTSS HHHHHHHHHHHHHHH :    
ExpBur          :--eeeebbeebe-eeebeeebeebeeeeeeebeeebeebbeebee:    
Contact         :                           bbbb                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123