Protein Model on 4rzp_B_1_A_1 (TEMPLATE: 4rzp )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [242 aa] Engineered Protein OR366
2 b A 1 (A) polymer(polypeptide(L)) [242 aa] Engineered Protein OR366 280D(S) 281G 282P(N) 283N(A) 322T(S) 323G 324T(N) 325D 363T(A) 364A(S) 365G 366R(N) 367Q(D) 370I 403N 406S 407G 408G(N) 409T(D) 449Q(S) 455G 456E(N) 457T 482E(S) 483S(K) 486K(Q) 493E 494K(N) 497S (identity: 41.4 %/33.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rzp_B_1 identity=33.6%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :*  ** ** ***                *    *  *   *    ** **          * **  **  * **    *******     ***      *:
4rzp_B_1       4:LEKLVELLTHDDSKTQQEAARDLAEIASGNASAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQ: 103
SecStr          :HHHHHHHTSS  HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTTS  HHHHHHHHHHHHHHTTS HHHHHHHHTTTHHHHHHHHTTSS HHHH:    
ExpBur          :beebbeebeeeeeeebbebbeebbeebeeeeebbeebbebebbeebbebbeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbebebeebb:    
Contact         :                           bbbb                                      bbbb                           

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : **     **  *    * **   *    **  *   * * * **  *  *  **   * *      *  * *  ***  * *       *  **     :
4rzp_B_1     104:QEAARALANIASGNDEAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIASGND-EAIKQVIDAGALEKLVELLTHDDSKVQQEAARALANIAS---: 199
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTTSS HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHHHS  HHHHHHHHHHHHHHTT---:    
ExpBur          :bbbbebbbbbbeeeeebbeebbeeebbebbbebbeeeeeebbbbbbbbbbbbbeeee-ebbeebbeeebbeebbebbeeeeeebbebbbbbbbbbbe---:    
Contact         :          bbbbb  b                                b  bbbb                                       b   

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  * *      *   * * *   *  *    *        *   *:
4rzp_B_1     200:--GNTSAIKQVI-DAGALEKLQELLTHDDSKVQQEAQRALENIKS: 241
SecStr          :--S HHHHHHHH-HTTHHHHHHHHHHS  SHHHHHHHHHHHHHH :    
ExpBur          :--beeebbeebe-eeebeeebeebeeeeeeebeebbeebbeebee:    
Contact         :  bbb                        bb  b      bb  b                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123