Protein Model on 4u2x_D_1_A_1 (TEMPLATE: 4u2x )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [170 aa] Importin subunit alpha-6 :IMA6_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [216 aa] Membrane-associated protein VP24 :VP24_EBOZM 387S(Q) 391F 392K(R) 394Q(R) 427N(D) 430T 431A(V) 432K(M) 465E 466E 468G(Y) 470L 471D 472K 474E 475A(F) 478N(S) 492I (identity: 50.0 %/50.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4u2x_D_1 identity=50.0%
queryA       331:VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLT: 430
                :     **     **  **  * *** ** ******   *** *      * *   * ** * * *** ** ** ***** *** ***  * * **  ***:
4u2x_D_1       4:ILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLT: 103
SecStr          :    S SHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHHT HHHHHHGGG:    
ExpBur          :eeeeeeeeebeeebebeeeeebbebbeebbeebeeeeeebeebbebebbeebbebbeebeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbe:    
Contact         :                                                        b   bb b                                b  b

queryA       431:AKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYF: 496
                :  * **  * *    **    *         *      ***  ****** ** ***   *     *** **:
4u2x_D_1     104:VMDSKIVQVALNGLENILRLGEQESKQXXIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYF: 174
SecStr          : S HHHHHHHHHHHHHHHHHHHHHHH --  S HHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHT:    
ExpBur          :beeeebbbbbbebbbbbbebbeeebee--eeebebbeebeebebeebbeebeeeeeeebeeebeebbeebe:    
Contact         :bb                                     bb b bbb bb  b             b                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123