Protein Model on 4u54_A_1_B_1 (TEMPLATE: 4u54 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (A) non-polymer(3C5) N-methyl-1-[3-(pyridin-3-yl)phenyl]methanamine 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4u54_A_1 identity=94.4%
queryA        74:VNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS: 173
                :***** ******** * * ************************************* *******************************************:
4u54_A_1       1:VNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS: 100
SecStr          :    HHHHHHHHTSS HHHHHHHHHHHHHHHH SSS  HHHHHHTTHHHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT :    
ExpBur          :eeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbeebbebbeb:    

queryA       174:PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW: 273
                :********************* ******* ** *********** * ************************* **************** ******* **:
4u54_A_1     101:PHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCW: 200
SecStr          :S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTTSS HHHHHHHHH:    
ExpBur          :eeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbeebbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbbbbe:    

queryA       274:AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV: 373
                :************* **** ************ ************************ *******************************************:
4u54_A_1     201:AISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV: 300
SecStr          :HHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHH:    
ExpBur          :bbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbeeb:    
Contact         :                                                                                      bb  b         

queryA       374:VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI: 473
                :********** ************* ** **************************** ******* ***********************************:
4u54_A_1     301:VNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI: 400
SecStr          :HHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHHHH:    
ExpBur          :beeebbeebbebbeeeeeebbebbbebbbebbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeebbeebbeebeeebbeeeb:    
Contact         :                      b  b   b                                                                      

queryA       474:EALQNHENESVYKASLSLIEKYFSV: 498
                :**** *********** ********:
4u54_A_1     401:EALQRHENESVYKASLNLIEKYFSV: 425
SecStr          :HTTTS S HHHHHHHHHHHHHHS  :    
ExpBur          :eebeeeeeeebeeebeebbeebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123