Protein Model on 4u5v_A_1_B_1 (TEMPLATE: 4u5v )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (A) non-polymer(RH2) N~2~-{[5-(pyridin-3-yl)thiophen-2-yl]methyl}-L-lysinamide 321V 322T 323G 328T 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4u5v_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
4u5v_A_1       1:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 100
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeebeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbbbbeeeeebbeebbeeebbeebbebb:    

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
4u5v_A_1     101:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 200
SecStr          :T SSHHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHGGG SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbbeebebbeebbeeebbeebbebbeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbbb:    

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
4u5v_A_1     201:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 300
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHH:    
ExpBur          :bebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbeeebeebbebbbebbbebbebeeebbe:    
Contact         :                                                 bbb    b                               bb  b       

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
4u5v_A_1     301:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 400
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbe:    
Contact         :                        b  b   b                                                                    

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
4u5v_A_1     401:KIEALQRHENESVYKASLNLIEKYFS: 426
SecStr          :HHHHTTS SSHHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebbeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123