Protein Model on 4uad_A_1_B_1 (TEMPLATE: 4uad )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-7 :IMA7_HUMAN
2 b B 1 (E) polymer(polypeptide(L)) [75 aa] Polymerase basic protein 2 :PB2_I75A3 104L 105S 107E 142W 146N 148A 149S 150G 151T 155T 181Q 184W 188N 191G 192D 231W 235N 238R 240K 270D 273W 277Y 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 353K 354E 357W 360S 361N 364A 396E 399W 402T 403N 406S 435K 438L(Q) 442D(N) 483S(E) 486K(Q) (identity: 91.7 %/52.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4uad_A_1 identity=52.0%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :  *    *     **  **  ***** *  ****  *        ** ** *      *** ************ *** *   ** * ** ** *     :
4uad_A_1      27:EMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDV: 126
SecStr          :HHHHHHTSS HHHHHHHHHHHHHHHT SSS  HHHHHHSTTHHHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHH:    
ExpBur          :ebeeebebeeeeebeebbeebbeebeeeeeeebeebbebeebbebbbebbeeeebeebbebbbebbbbbbeeeeebbeebbebebbebbbebbebeeeeb:    
Contact         :                        bb b                                   b   b bbbb   b                       

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : ************* ** ** *       *** **      *      **  * ****** *** *    *   ** * ***   *   *** *** ***:
4uad_A_1     127:QEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLT----KSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYL: 222
SecStr          :HHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHH----H   HHHHHHHHHHHHHHH   SS   GGGTGGGHHHHHHHTT   HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeeeebbeebbeeebbeebbebbe----ebeeeebbebbbebbbbbbeeeeeebeeeebeebbebbbebbeeebeebbbebbebbbbb:    
Contact         :  b  b   b  bb                                      b   b  b b                             b  b   b 

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ***** *  *   **   ** **         ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
4uad_A_1     223:SDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANI: 322
SecStr          :TSSSHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTT HHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT :    
ExpBur          :beeeeebbeebbeeebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeeeebbebbbebbbebbebeeebbeebbebeb:    
Contact         : bb b  b                            b   b bbb    b                        bb  b  bb  b              

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * *   * ** * * *** ** ** ***** *** ***  * * **  ***  * **  * *    **    *  *             ***  *****:
4uad_A_1     323:FPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKI: 422
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHGGGG S HHHHHHHHHHHHHHHHHHHHHTTTTS    TTHHHHHHTTHHHHH:    
ExpBur          :beebbebbeeeeeebeeebbebbbbbbeebbeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeebeeeeeeebebbeebeebebbebb:    
Contact         :                 b  b  bb  b                            b  b   b                                    

queryA       474:EALQNHENESVYKASLSLIEKYFSV: 498
                :* ** ***   *     *** ** *:
4uad_A_1     423:EFLQSHENQEIYQKAFDLIEHYFGV: 447
SecStr          :HHGGG S HHHHHHHHHHHHHHS  :    
ExpBur          :eebeeeeeeebeeebeebbeebbee:    
Contact         :         b  b                                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123