Protein Model on 4uae_A_1_B_1 (TEMPLATE: 4uae )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [417 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b B 1 (F) polymer(polypeptide(L)) [74 aa] Polymerase basic protein 2 :PB2_I75A3 104L 105S 107E(D) 108K(R) 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 192D 228N 231W 235N 238R 269A(V) 273W 280D 308P(K) 315R 319N 321V 322T 323G 328T 350N(K) 354E 357W 360S 361N 396E 399W 402T(S) 403N 406S(I) 435K(Q) 438L(Q) 439V 442D 482E 483S(D) (identity: 79.6 %/54.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4uae_A_1 identity=54.5%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** *** :
4uae_A_1       6:SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ: 105
SecStr          : HHHHHHHTT SSHHHHHHHHHHHHHHTSSSSS  HHHHHHTTHHHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHTTT HHHHHHHTT S H:    
ExpBur          :eeeebbeebeeeeeeebbebbeebbeebeeeeeeebeebeeeebbebbbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbebbebeee:    
Contact         :                           bb bb b                           b   b   b bbbbb  b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** ** *:
4uae_A_1     106:NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALS: 201
SecStr          :HHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHS S----TTS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeebeebbeebbeeebbebbbebee----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbeeebeebbbebbebbb:    
Contact         :    b  b  bb   b                                   b  b   b  b                              b   b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH: 376
                :****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * *   :
4uae_A_1     202:YLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA: 301
SecStr          :HHHHS HHHHHHHHHHT HHHHGGGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTGGGGSHHHHS S HHHHHHHHHHHHHHTTS HHHHHHHHHT:    
ExpBur          :ebbeeeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebeeeebbebbbbbbbebbebeeebbeebbee:    
Contact         :   b                           b      b   b bbb    b                     b   b  b  bb               

queryA       377:GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL: 476
                : ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* *** *:
4uae_A_1     302:NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQL: 399
SecStr          :T HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHGGGGSS HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHHTT:    
ExpBur          :ebbeebbebbeebeebbbebbbebbbbbbeebeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbeebee--eeeebbeebeeebbbeebeeb:    
Contact         :                   b  b  bb  b                            b  bb  b                                  

queryA       477:QNHENESVYKASLSLIEKYFS: 497
                :******  **     *   **:
4uae_A_1     400:QNHENEDIYKLAYEIIDQFFS: 420
SecStr          : STTSHHHHHHHHHHHHHHS :    
ExpBur          :eeeeeeebeebbeebbeeebe:    
Contact         :     bb                                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123