Protein Model on 4uae_A_1_C_1 (TEMPLATE: 4uae )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [417 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b C 1 (A) non-polymer(SO4) SULFATE ION 239N(H) 240K 241N(D) (identity: 33.3 %/54.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4uae_A_1 identity=54.5%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** *** :
4uae_A_1       6:SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ: 105
SecStr          : HHHHHHHTT SSHHHHHHHHHHHHHHTSSSSS  HHHHHHTTHHHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHTTT HHHHHHHTT S H:    
ExpBur          :eeeebbeebeeeeeeebbebbeebbeebeeeeeeebeebeeeebbebbbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbebbebeee:    

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** ** *:
4uae_A_1     106:NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALS: 201
SecStr          :HHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHS S----TTS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeebeebbeebbeeebbebbbebee----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbeeebeebbbebbebbb:    
Contact         :                                                              bbb                                   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH: 376
                :****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * *   :
4uae_A_1     202:YLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA: 301
SecStr          :HHHHS HHHHHHHHHHT HHHHGGGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTTGGGGSHHHHS S HHHHHHHHHHHHHHTTS HHHHHHHHHT:    
ExpBur          :ebbeeeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebeeeebbebbbbbbbebbebeeebbeebbee:    

queryA       377:GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL: 476
                : ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* *** *:
4uae_A_1     302:NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQL: 399
SecStr          :T HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHGGGGSS HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHHTT:    
ExpBur          :ebbeebbebbeebeebbbebbbebbbbbbeebeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbeebee--eeeebbeebeeebbbeebeeb:    

queryA       477:QNHENESVYKASLSLIEKYFS: 497
                :******  **     *   **:
4uae_A_1     400:QNHENEDIYKLAYEIIDQFFS: 420
SecStr          : STTSHHHHHHHHHHHHHHS :    
ExpBur          :eeeeeeebeebbeebbeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123