Protein Model on 4uaf_A_1_B_1 (TEMPLATE: 4uaf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (E) polymer(polypeptide(L)) [72 aa] Polymerase basic protein 2 :PB2_I75A3 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 350N 353K 354E 357W 360S 361N 396E 399W 402T 403N 406S 435K 438L(Q) 439V 442D 482E 483S (identity: 98.1 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4uaf_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
4uaf_A_1       9:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 108
SecStr          :  SS  HHHHHHHHTSS HHHHHHHHHHHHHHHHSSSS  HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeebeebeebbeeeeeeebbebbebbbbbbeeeeeeebeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebb:    
Contact         :                                bbbb  b                           b   b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
4uaf_A_1     109:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 208
SecStr          :T S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   TT   HHHHHHHHHHHHHHTTSS HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebeebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbb:    
Contact         :         b  b   b  bb                                   b  b   b  b                                 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
4uaf_A_1     209:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 308
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbe:    
Contact         : b   b  bb b  b                            b   b bbb    b                     b  bb  b  bb          

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
4uaf_A_1     309:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 408
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbebbbebbbbbbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeeeeebbeebeebebee:    
Contact         :                        b  b  bb  b                            b  bb  b                             

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
4uaf_A_1     409:KIEALQRHENESVYKASLNLIEKYF: 433
SecStr          :HHHHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :ebeebeeeeeeebeeebeebbeebe:    
Contact         :          bb                                                                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123