Protein Model on 4v3q_B_1_O_1 (TEMPLATE: 4v3q )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [247 aa] YIII_M4_AII
2 b O 1 (B) non-polymer(CA) CALCIUM ION 364A(S) (identity: 0.0 %/38.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4v3q_B_1 identity=38.2%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    *  * *  *   *  * ** **      *   **   ***  * *** * *******     **  *   * :
4v3q_B_1      10:LPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQIL: 109
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHH:    
ExpBur          :beebbeebebeeeeebbebbeebbebbeeeeeebeebbebebbebbbebbeeeeeebbeebbebbbbbbebbeebbbebbeeebbeebbebbeeeeeebb:    

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : ** **  **  *   *** *   *  * **  **        ** *   *  ***  ***      *    *  **      *    *    **     :
4v3q_B_1     110:QEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGD-EQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASG--: 206
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS--:    
ExpBur          :ebbbebbbbbbebeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebee-ebbbbbbeeebbebbbebbebeeeebbbbbbebbbbbbeb--:    
Contact         :           b                                                                                        

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  *   *      * * * * * ** ****   *      **  *:
4v3q_B_1     207:--GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 247
SecStr          :-- HHHHHH--HHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHH :    
ExpBur          :--beebbeb--beeeebbebbeebeeeeeeebeebbeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123