Protein Model on 4wv6_A_1_O_1 (TEMPLATE: 4wv6 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b O 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 366R 367Q 368D (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wv6_A_1 identity=100.0%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :****************************************************************************************************:
4wv6_A_1      14:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 113
SecStr          :  HHHHHHHHHHHHT SSHHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :eeeeeebeebeebbebeeeeebbebbeebeebbeeeeeebbebbeeeebbeebeebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :****************************************************************************************************:
4wv6_A_1     114:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 213
SecStr          :T S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHH  S GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeeebeebbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbeb:    

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :****************************************************************************************************:
4wv6_A_1     214:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 313
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHHT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebbbbbbbbbbebbebeeebbe:    
Contact         :                                                                                              bbb   

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :****************************************************************************************************:
4wv6_A_1     314:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 413
SecStr          :HHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeebeeebbeebbebbbbbbeebeeebbeebbebebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbe:    

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :**************************:
4wv6_A_1     414:KIEALQNHENESVYKASLSLIEKYFS: 439
SecStr          :HHHHGGG S HHHHHHHHHHHHHH  :    
ExpBur          :ebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123