Protein Model on 4xzr_B_1_A_1 (TEMPLATE: 4xzr )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [423 aa] Importin subunit alpha :IMA1_YEAST
2 b A 1 (A) polymer(polypeptide(L)) [18 aa] Inner nuclear membrane protein SRC1 :SRC1_YEAST 104L 105S 106R 142W 146N 148A 149S 150G 151T 155T 180E 181Q 184W 187G 188N 191G 192D 231W 235N 238R 240K 270D 273W 277Y 281G 286I 319N 321V 322T 323G 328T 353K 357W 360S 361N 363T 364A 365G 395K 396E 399W 403N 406S 435K(R) 436I 442D (identity: 97.8 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4xzr_B_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
4xzr_B_1       6:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 105
SecStr          :SSTTTSSS HHHHHHHHHHHHHHHS SSS  HHHHHTTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :ebebbeeeeeeebeebbeebbeebeeeeebebeebbebebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebbb:    
Contact         :                       bbb                                   b   b bbbb   b                        b

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
4xzr_B_1     106:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 200
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT-----TS  HHHHHHHHHHHHHHH   TT   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbeeeeebbbebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbebbbebbe:    
Contact         :b  b  bb  bb                                      b   b  b b                             b  b   b   

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
4xzr_B_1     201:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 300
SecStr          :SSHHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbebbbebbebebeebbbbbbebbbbbbebeeebbeebbeeebbebbeebbebeeeebeebbbebbbebbeeeeebbeebbeeebbe:    
Contact         :b    b                                b bbb    b                        b   b  bb bbb               

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
4xzr_B_1     301:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 400
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHHGGGT HHHHHHHHHTT HHHHHHHTTTS HHHHHHHHHHHHHHHHHHHHHHHHTT S  HHHHHHHHTT HHHH:    
ExpBur          :ebbebbeebeeebbbbbbebbbebbebbeeeeebbeebbeeebbebbbebbeebeeebbebbbebbbebbebbeebeeeeeeeebebbeebeebebeebb:    
Contact         :              bb  b   b  b                              bb     b                                    

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
4xzr_B_1     401:FNCQQNENDKIYEKAYKIIETYF: 423
SecStr          :TTSSSSS TTSHHHHHHHHHHH :    
ExpBur          :eebeebeeeebeebbeebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123