Protein Model on 4yi0_A_1_B_1 (TEMPLATE: 4yi0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (C) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (A) polymer(polypeptide(L)) [27 aa] Nuclear envelope pore membrane protein POM 121 :PO121_RAT 101R 102K 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 234S 235N 238R 270D 273W 277Y 280D 281G 283N 286I 311T 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yi0_A_1 identity=94.4%
queryA        73:TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 172
                :****** ******** * * ************************************* ******************************************:
4yi0_A_1       4:TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 103
SecStr          : TT  HHHHHHHHTSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT:    
ExpBur          :eeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbe:    
Contact         :                            bb bbbb  b                           b   b   b bbbbb  b                 

queryA       173:SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC: 272
                :********************** ******* ** *********** * ************************* **************** ******* *:
4yi0_A_1     104:SPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSC: 203
SecStr          : SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHHH:    
ExpBur          :beeeebbebbbebbbbbbeebeebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebb:    
Contact         :        b  b   b  bb                                   b  b  bb  b                               b  

queryA       273:WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 372
                :************** **** ************ ************************ ******************************************:
4yi0_A_1     204:WAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 303
SecStr          :HHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :ebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbbbbbebbbebbebeeebbee:    
Contact         :b   b  bb b  b                        b   b   b bbb    b                         b  b  bb  b        

queryA       373:VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 472
                :*********** ************* ** **************************** ******* **********************************:
4yi0_A_1     304:VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 403
SecStr          :HHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTHHHH:    
ExpBur          :bbeeebbeebbebbeeeeeebbbebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbeebbebbeeeeeeeebbeebeeeebbee:    
Contact         :                       b  b                                                                         

queryA       473:IEALQNHENESVYKASLSLIEKYFS: 497
                :***** *********** *******:
4yi0_A_1     404:IEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHGGG SSHHHHHHHHHHHHHHT :    
ExpBur          :beebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123