Protein Model on 5aei_B_1_E_1 (TEMPLATE: 5aei )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [282 aa] DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII
2 b E 1 (E) polymer(polypeptide(L)) [10 aa] KR5 142W(R) 146N(Q) 149S 181Q(E) 184W 187G(S) 188N 191G(S) 192D(G) 228N(E) 231W 235N 238R(S) 242P(I) 273W 276S 277Y(N) 280D(S) 281G 312P(E) 315R(W) 318G(S) 319N 322T(S) 354E 357W (identity: 42.3 %/39.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5aei_B_1 identity=39.9%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5aei_B_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHHTT S HHHHH-HHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHHTHHHHHHHHTT S HH-:    
ExpBur          :beebbebbebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbeeeeeebbbbbbebbbebbebbeebbbbbbeeebbeebbebbeeeeee-:    
Contact         :                     b   b  b                               b  b  bb  bb                            

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5aei_B_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :----bbebbbebbbbbbebeeebbbbbbeee--bbeebbebbeeeeeebbbbbbebbbebbebeeebbbbbbeeebbeebbebbeeeeeebbbbbbebbb:    
Contact         :       b  b   b  bb    b                              b  bb  bb                              b  b  b

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
5aei_B_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHH :    
ExpBur          :bbbebeeebbbbbbeeebbeebbebbebeeeebbbbbbebbbebbebeeebbebbeeeebeebbeebeebeeeebeebbeebbeebee:    
Contact         :b  b                               b  b                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123