Protein Model on 5b56_A_1_E_1 (TEMPLATE: 5b56 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [429 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b E 1 (E) polymer(polypeptide(L)) [12 aa] Protein Vpr :VPR_HV1B9 105S 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5b56_A_1 identity=94.4%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :********* ******** * * ************************************* ***************************************:
5b56_A_1       1:NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 100
SecStr          :  SSSS  HHHHHHHHSSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHHS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeeeeebbeebbeebbeeeeeeebeebbebbeebbeeeeeebbeebeeeebbeebbebbeeeebbebbebbbebbbbbbeeeeebbebbbeeebbebbbe:    
Contact         :                                   b                                b   b   b bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :************************* ******* ** *********** * ************************* **************** ******:
5b56_A_1     101:LLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLA: 200
SecStr          :HTT S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHH SS GGGS HHHHHHHHHHHHHTT   SS   HHHHHHHHHHHHHHHT S HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebbebbbebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbb:    
Contact         :           b  b   b  bb                                   b  b   b  b                               

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :* *************** **** ************ ************************ ***************************************:
5b56_A_1     201:DSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 300
SecStr          :HHHHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGTHHHHHT SSHHHHHHHHHHHHHHTTS HHH:    
ExpBur          :bbbebbbbbbeeeeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebeebbbebbbebbebeeeb:    
Contact         :   b                                                                                                

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :************** ************* ** **************************** ******* *******************************:
5b56_A_1     301:IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGG: 400
SecStr          :HHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeebeeebbebbbebbbebbeebeeebbeebbebebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebeb:    

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFSV: 498
                :******** *********** ********:
5b56_A_1     401:LDKIEALQRHENESVYKASLNLIEKYFSV: 429
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHHS  :    
ExpBur          :eeebeebeeeeeeebeebbeebbeebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123