Protein Model on 5b56_B_1_C_1 (TEMPLATE: 5b56 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [432 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b C 1 (C) polymer(polypeptide(L)) [12 aa] Protein Vpr :VPR_HV1B9 482E (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5b56_B_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
5b56_B_1       2:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 101
SecStr          :       HHHHHHHHSSS HHHHHHHHHHHHHHHHSSS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHH:    
ExpBur          :eeeeeeeeeebeebbeeeeeeebbebbebbeebbeeeeebbbeebeeeebbeebbebbeeeebbebbebbbebbbbbbeeeeebbebbbeeebbebbbeb:    

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
5b56_B_1     102:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 201
SecStr          :TT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHH SS GGGS HHHHHHHHHHHHHHS   SS   HHHHHHHHHHHHHHTT S HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
5b56_B_1     202:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 301
SecStr          :HHHHHHHHTSS HHHHHHHHTTS HHHHHHHHT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTTGGGTHHHHHT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbbbbeeeeeebebbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebeebbbebbbebbebeeebb:    

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
5b56_B_1     302:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 401
SecStr          :HHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHTTTHH:    
ExpBur          :eebbeeebbeebbbbbeebeeebbebbbebbbebbeebeeebbeebbebebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeebebb:    

queryA       471:DKIEALQNHENESVYKASLSLIEKYFSVEEEE: 502
                :******* *********** ************:
5b56_B_1     402:DKIEALQRHENESVYKASLNLIEKYFSVEEEE: 433
SecStr          :HHHHHTTSSS SHHHHHHHHHHHHHS SSS  :    
ExpBur          :eebeebbeeeeeebeebbeebbeebbeeeeee:    
Contact         :           b                                                                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123