Protein Model on 5ctt_A_1_B_1 (TEMPLATE: 5ctt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [16 aa] Squamous cell carcinoma antigen recognized by T-cells 3 :SART3_HUMAN 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 234S 235N 238R 270D 273W 277Y 311T 315R 319N 321V 322T 323G 328T 354E 357W 360S 361N 364A 396E 399W 403N 406S 407G (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5ctt_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
5ctt_A_1      22:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 121
SecStr          :  TT  HHHHHHHHTTS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebb:    
Contact         :                                bbbb  b                           b   b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
5ctt_A_1     122:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 221
SecStr          :T S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbeb:    
Contact         :         b  b   b  bb                                   b  b  bb  b                               b 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
5ctt_A_1     222:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 321
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbbbbbebbbebbebeeebbe:    
Contact         : b   b                                 b   b   b bbb    b                         b  b  bb  b       

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
5ctt_A_1     322:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 421
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTT HH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbebbeebebebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeebebee:    
Contact         :                        b  b   b  bb                                                                

queryA       472:KIEALQNHENESVYKASLSLIEKYFS: 497
                :****** *********** *******:
5ctt_A_1     422:KIEALQRHENESVYKASLNLIEKYFS: 447
SecStr          :HHHHHTT SSHHHHHHHHHHHHHHH :    
ExpBur          :ebeebeeeeeeebeeebeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123