Protein Model on 5d5k_A_1_B_1 (TEMPLATE: 5d5k )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (C) polymer(polypeptide(L)) [424 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [16 aa] Poly [ADP-ribose] polymerase 2 :PARP2_HUMAN 104L 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 270D 273W 277Y 280D 319N 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5d5k_A_1 identity=94.3%
queryA        73:TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 172
                :****** ******** * * ************************************* ******************************************:
5d5k_A_1      10:TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 109
SecStr          :  S  HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTTHHHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT:    
ExpBur          :eeeeebeebeebbeeeeeeebbebbebbeebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebbe:    
Contact         :                               bbbb  b                           b   b   b bbbbb  b                 

queryA       173:SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC: 272
                :********************** ******* ** *********** * ************************* **************** ******* *:
5d5k_A_1     110:SPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSC: 209
SecStr          : S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHS   SS   HHHHHHHHHHHHHHTTSS HHHHHHHH:    
ExpBur          :beeeebbebbbebbbbbbeebeebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbebb:    
Contact         :        b  b  bb  bb                                      b   b  b                               b  

queryA       273:WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 372
                :************** **** ************ ************************ ******************************************:
5d5k_A_1     210:WAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 309
SecStr          :HHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :ebbbbbbeeeeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebebbbbbbbbebbebeeebbee:    
Contact         :b   b  b                                      b bbb    b                            b  bb  b        

queryA       373:VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 472
                :*********** ************* ** **************************** ******* **********************************:
5d5k_A_1     310:VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 409
SecStr          :HHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTHHHH:    
ExpBur          :bbeeebbeebbebbeeeeeebbebbbebbbebbeebeeebbeebbebebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebbbeee:    
Contact         :                       b  b   b                                                                     

queryA       473:IEALQNHENESVYKASLSLIEKYF: 496
                :***** *********** ******:
5d5k_A_1     410:IEALQRHENESVYKASLNLIEKYF: 433
SecStr          :HHHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :beebeebeeeebeeebeebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123