Protein Model on 5gxw_A_1_B_1 (TEMPLATE: 5gxw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [428 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [27 aa] Peptide from Nuclear mitotic apparatus protein 1 :NUMA1_HUMAN 105S 107E 138F 142W 145T 146N 148A 149S 150G 151T 152S 155T 177H 181Q 184W 187G 188N 191G 192D 228N 231W 235N 238R 239N 240K 273W 277Y 280D 315R 319N 321V 322T 323G 325D 328T 357W 360S 361N 364A 365G 366R 396E 399W 403N 406S (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5gxw_A_1 identity=94.4%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :********* ******** * * ************************************* ***************************************:
5gxw_A_1       1:NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 100
SecStr          :  TTSS  HHHHHHHHHSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeeeeeeebeebbeeeeeeebbebbebbbbbbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbe:    
Contact         :                                   b b                              b   b  bb bbbbb  b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :************************* ******* ** *********** * ************************* **************** ******:
5gxw_A_1     101:LLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLA: 200
SecStr          :HTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHH:    
ExpBur          :bbebeeeebbebbbebbbbbbeebeebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbb:    
Contact         :       b   b  b  bb  bb                                   b  b   b  bbb                             

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :* *************** **** ************ ************************ ***************************************:
5gxw_A_1     201:DSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 300
SecStr          :HHHHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHH:    
ExpBur          :ebbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeeb:    
Contact         :   b   b  b                                  b   b bbb b  b                            b  bb  bbb   

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :************** ************* ** **************************** ******* *******************************:
5gxw_A_1     301:IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGG: 400
SecStr          :HHHHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTT   HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbbbbbebbeebbebbeeeeeeeebbeebeebeb:    
Contact         :                          b  b   b  b                                                               

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :******** *********** *******:
5gxw_A_1     401:LDKIEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHHHHGGG S HHHHHHHHHHHHHH  :    
ExpBur          :beebeebbebeeeebeebbeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123