Protein Model on 5h2w_A_1_B_1 (TEMPLATE: 5h2w )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [416 aa] Importin subunit alpha :IMA1_YEAST
2 b B 1 (B) polymer(polypeptide(L)) [17 aa] Ubiquitin-like-specific protease 1 :ULP1_YEAST 104L 105S 106R 107E 110P 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 235N 238R 240K 241N(K) 270D 280D 315R 319N 321V 322T 323G 328T 353K 354E 357W 360S 361N 364A 396E 399W 403N (identity: 97.5 %/50.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5h2w_A_1 identity=50.1%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
5h2w_A_1       5:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 104
SecStr          :HHHHHT S HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :beeebeeeeeeebeebbeebbeebebeeeeebeebbeeebbebbbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebeb:    
Contact         :                       bbbb  b                               b   b bbbbb  b                         

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
5h2w_A_1     105:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 199
SecStr          :HHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----G S HHHHHHHHHHHHHHH   SS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeeebbebbebbbebbeeeeeebbbebbebbbebbe:    
Contact         :b  b   b  bb                                      b   b  b bb                            b         b

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
5h2w_A_1     200:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 299
SecStr          :S HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbebbbeeebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbebebbebbeebbebeebebbebbbebbbebbebeeebbeebbebebbe:    
Contact         :                                  b   b bbb    b                        bb  b  bb  b                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI---------MIEECGG: 469
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **     * **  *             **  **:
5h2w_A_1     300:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENIL----KMGEADKEAXXXXXNENADFIEKAGG: 395
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHGGGTT THHHHHHHHTT HHHHHHHTTTS HHHHHHHHHHHHHHH----HHHHHHHH ----- HHHHHHHHTTH:    
ExpBur          :ebbebbeebeeebeebbbebbbbbbebbeeeeebbeebbeeebbebbbebbeebeeebbebbbebbbebb----ebbeeeeee-----eebbeebeebeb:    
Contact         :               b  b   b                                                                             

queryA       470:LDKIEALQNHENESVYKASLSLIEKYF: 496
                :  **   *  **   *      ** **:
5h2w_A_1     396:MEKIFNCQQNENDKIYEKAYKIIETYF: 422
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :eeebeebbeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123