Protein Model on 5h43_A_1_B_1 (TEMPLATE: 5h43 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [428 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [10 aa] Histone acetyltransferase KAT8 :KAT8_HUMAN 240K 281G 315R 321V 322T 323G 325D 328T 353K 354E 357W 360S 361N 364A 365G 366R 396E 399W 402T 403N 406S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5h43_A_1 identity=100.0%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :****************************************************************************************************:
5h43_A_1       2:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 101
SecStr          :   GGG  HHHHHHHHHSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeebeeeebbebbeeeeeeebbbbbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbebbeeeeebbebbbeeebbebbbe:    

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :****************************************************************************************************:
5h43_A_1     102:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 201
SecStr          :HTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHHSSS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT   HHHHH:    
ExpBur          :bbebeeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeeebebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbb:    
Contact         :                                                                      b                             

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :****************************************************************************************************:
5h43_A_1     202:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 301
SecStr          :HHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT TTSTTHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHHH SSHHHHHHHHHHHHHHHTS HHH:    
ExpBur          :bbbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeeb:    
Contact         :           b                                 b     bbb b  b                        bb  b  bb  bbb   

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :****************************************************************************************************:
5h43_A_1     302:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 401
SecStr          :HHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeebeeebbebbbebbbbbbeebeeebbeebeeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebeb:    
Contact         :                          b  b  bb  b                                                               

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :****************************:
5h43_A_1     402:LDKIEALQNHENESVYKASLSLIEKYFS: 429
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHHH :    
ExpBur          :beebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123