Protein Model on 5h43_A_1_C_1 (TEMPLATE: 5h43 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [428 aa] Importin subunit alpha-1 :IMA1_HUMAN
2 b C 1 (C) polymer(polypeptide(L)) [15 aa] Histone acetyltransferase KAT8 :KAT8_HUMAN 104L 105S 106R 107E 138F 142W 146N 148A 149S 150G 151T 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 239N 265P 266E 269A 270D 273W 277Y 308P 311T (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5h43_A_1 identity=100.0%
queryA        70:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 169
                :****************************************************************************************************:
5h43_A_1       2:NQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFIS: 101
SecStr          :   GGG  HHHHHHHHHSS HHHHHHHHHHHHHHHTSSS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :eeebeebeeeebbebbeeeeeeebbbbbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbebbeeeeebbebbbeeebbebbbe:    
Contact         :                                  bbbb                              b   b   b bbbb   b              

queryA       170:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 269
                :****************************************************************************************************:
5h43_A_1     102:LLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLA: 201
SecStr          :HTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHHSSS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT   HHHHH:    
ExpBur          :bbebeeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeeebebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbb:    
Contact         :           b  b  bb  bb                                      b   b  bb                         bb  b

queryA       270:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 369
                :****************************************************************************************************:
5h43_A_1     202:DTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ: 301
SecStr          :HHHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT TTSTTHHHHHHHHHHHTTS HHHHHHHHHHTGGGGHHHHHH SSHHHHHHHHHHHHHHHTS HHH:    
ExpBur          :bbbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeeb:    
Contact         :b  b   b                              b  b                                                          

queryA       370:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 469
                :****************************************************************************************************:
5h43_A_1     302:IQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGG: 401
SecStr          :HHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHTTH:    
ExpBur          :beebbeeebbeebbebbeebeeebbebbbebbbbbbeebeeebbeebeeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeebeb:    

queryA       470:LDKIEALQNHENESVYKASLSLIEKYFS: 497
                :****************************:
5h43_A_1     402:LDKIEALQNHENESVYKASLSLIEKYFS: 429
SecStr          :HHHHHHGGG SSHHHHHHHHHHHHHHH :    
ExpBur          :beebeebeeeeeeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123