Protein Model on 5huw_A_1_C_1 (TEMPLATE: 5huw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (C) polymer(polypeptide(L)) [423 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b C 1 (B) polymer(polypeptide(L)) [6 aa] HSV1 large terminase NLS 280D 281G 283N 286I 315R 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N 406S 407G (identity: 100.0 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5huw_A_1 identity=94.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :**** ******** * * ************************************* ********************************************:
5huw_A_1      74:NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 173
SecStr          :   HHHHHHHHTT  HHHHHHHHHHHHHHHHHSSS  HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbbebbeeeeeeebeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbebbbebbebe:    

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :******************** ******* ** *********** * ************************* **************** ******* ***:
5huw_A_1     174:HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA: 273
SecStr          :SHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTTSS HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebbeb:    

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :************ **** ************ ************************ ********************************************:
5huw_A_1     274:ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 373
SecStr          :HHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbeebb:    
Contact         :     bb b  b                            b     bbb    b                            b  bb  b          

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :********* ************* ** **************************** ******* ************************************:
5huw_A_1     374:NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 473
SecStr          :HTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebeeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbeebe:    
Contact         :                     b  b   b  bb                                                                   

queryA       475:ALQNHENESVYKASLSLIEKYFS: 497
                :*** *********** *******:
5huw_A_1     474:ALQRHENESVYKASLNLIEKYFS: 496
SecStr          :HHTT SSSTTHHHHHHHHHHHT :    
ExpBur          :ebeebebeebeeebeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123