Protein Model on 5k9s_A_1_C_1 (TEMPLATE: 5k9s )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b C 1 (C) polymer(polypeptide(L)) [11 aa] HNF1 beta A splice variant 2 315R 319N 321V 322T 323G 325D 328T 354E 357W 361N 364A 395K 396E 399W 403N 406S 435K (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5k9s_A_1 identity=94.4%
queryA        74:VNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS: 173
                :***** ******** * * ************************************* *******************************************:
5k9s_A_1       3:VNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLAS: 102
SecStr          :    HHHHHHHHHSS HHHHHHHHHHHHHHHSSSS   HHHHHHTTHHHHHHHHTT SS HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT :    
ExpBur          :eeeeeeebeebbeeeeeeebbebbebbeebbeeeeeebbeebeeeebbeebeebbeeeebbebbebbbebbbebbeeeeebbebbbeeebbebbbebbeb:    

queryA       174:PHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCW: 273
                :********************* ******* ** *********** * ************************* **************** ******* **:
5k9s_A_1     103:PHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCW: 202
SecStr          :SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHHT   HHHHHHHHH:    
ExpBur          :eeeebbebbbebbbbbbeebbebbbebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbebbe:    

queryA       274:AISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV: 373
                :************* **** ************ ************************ *******************************************:
5k9s_A_1     203:AISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQV: 302
SecStr          :HHHHHTSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGTHHHHHT SSHHHHHHHHHHHHHHTTS HHHHHHH:    
ExpBur          :bbbbbbeeeeebbebbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbebeeeebeebbbebbbebbebeeebbeeb:    
Contact         :                                         b   b bbb b  b                         b  b   b  b         

queryA       374:VNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI: 473
                :********** ************* ** **************************** ******* ***********************************:
5k9s_A_1     303:VNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKI: 402
SecStr          :HHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHHHH:    
ExpBur          :beeebbeebbebbeebeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeebebeeeb:    
Contact         :                     bb  b   b  b                            b                                      

queryA       474:EALQNHENESVYKASLSLIEKYFSV: 498
                :**** *********** ********:
5k9s_A_1     403:EALQRHENESVYKASLNLIEKYFSV: 427
SecStr          :HHGGG SSHHHHHHHHHHHHHHS  :    
ExpBur          :eebeeeeeeebeeebeebeeebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123