Protein Model on 5mfc_C_1_D_1 (TEMPLATE: 5mfc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [282 aa] YIIIM5AII
2 b D 1 (D) polymer(polypeptide(L)) [238 aa] (KR)4-Green fluorescent protein,Green fluorescent protein :A0A059PIQ0_AEQVI 142W(R) 146N(Q) 149S 150G 152S(N) 155T(I) 184W 190A 191G(S) 192D(G) 197R(I) 228N(E) 231W 235N 238R(S) 265P(E) 266E(Q) 269A(Q) 270D(E) 273W 276S 277Y(N) 280D(S) 281G 282P(G) 283N 286I 307L(E) 308P(Q) 311T(Q) 312P(E) 315R(W) 319N 322T(S) 323G 325D(N) 348K(N) 357W 360S 361N 364A(S) (identity: 39.0 %/40.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfc_C_1 identity=40.5%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfc_C_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHHTT SSHHHHH-HHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :beebbeebebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbeebbeeebbebbbebbebebee-:    
Contact         :                     b   b  bb b  b                            b     bbb    b                       

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfc_C_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT-- HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHTTS S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbbbbebeeebbeebbeee--bbebbbebbebeeeebbebbbebbbebbeeeeebbeebbeeebbebbbebbebebeebbebbbebbb:    
Contact         :       b  b   b  bb                           bb  bb  b  bb  bbbb  b                    bb  bb  b   

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA: 397
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****:
5mfc_C_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA: 276
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHTTT S HHHHHHHHHHHHHHHTS HHHHHHHHHHTHHHHHHHTTSSS HHHHHHH:    
ExpBur          :bbbebeeebbebbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbebbeeeebeeebeebeeeebeebeeeb:    
Contact         :b  bb b                      b        b  bb  b                                                      


Input Residue Numbers for Focused Sites

ex) 2,15,123