Protein Model on 5mfd_C_1_D_1 (TEMPLATE: 5mfd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [323 aa] YIIIM''6AII
2 b D 1 (D) polymer(polypeptide(L)) [107 aa] Capsid decoration protein,pD_(KR)5 :DECO_LAMBD 148A 149S 150G 155T(I) 184W 188N 191G(S) 192D(G) 194S(N) 197R(I) 231W 235N 238R(S) 239N 242P(I) 270D(E) 273W 277Y(N) 280D(S) 281G 282P(G) 312P(E) 315R(W) 319N 354E 357W (identity: 50.0 %/39.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfd_C_1 identity=39.4%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  **  *    :
5mfd_C_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHHHHSS HHHHH-HHHHHHHHHHTS HHHHHHHHHHT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :beebbebbebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeebbebbbeeebbeebbebbeeeeee-:    
Contact         :                           bbb    b                            b   b  bb b  b                       

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    *** *     *      ***    ** ** **       *    *       * ** *  *   *  * ** **      *   **   *:
5mfd_C_1     104:----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLG: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbbbbebbeebbbbbbeee--bbeebbebbeeeeeebbebbbebbbbbbebeeebbebbbeeebbeebbebbeeeeeebbbbbbebbb:    
Contact         :          b   b  bb b  b                           b  b   b  bbb                             b  b   

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH: 418
                :**  *  ** * *******     **  *   *  ** **  **  *   *** *   *  * **  **        ** *   *  ***  **      :
5mfd_C_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE: 296
SecStr          :HHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHHTS H-HHHHHHHH:    
ExpBur          :bbbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebee-ebbebbee:    
Contact         :b                                  b  b                                                             

queryA       419:CGIIEPLMNLLTAKDTKI: 436
                : *  * *  *      **:
5mfd_C_1     297:AGALEKLEQLQSHENEKI: 314
SecStr          :TTHHHHHHHGGG S HHH:    
ExpBur          :eebeeebeebeeeeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123