Protein Model on 5mfd_G_1_FA_1 (TEMPLATE: 5mfd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) G 1 (G) polymer(polypeptide(L)) [322 aa] YIIIM''6AII
2 b FA 1 (G) non-polymer(CA) CALCIUM ION 174P 176A(E) (identity: 50.0 %/39.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfd_G_1 identity=39.4%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  **  *    :
5mfd_G_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHGGG S HHHHH-HHHHHHHHHTTSHHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :eeebbeebebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbeeeeeebbbbbbebbbbbbebbeebbebbbeeebbebbbebbeeeeee-:    
Contact         :                                                     b b                                            

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    *** *     *      ***    ** ** **       *    *       * ** *  *   *  * ** **      *   **   *:
5mfd_G_1     104:----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLG: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT-- HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbbbbebbeebbeebbeee--bbeebbebbeeeeeebbebbbebbbbbbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbb:    

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH: 418
                :**  *  ** * *******     **  *   *  ** **  **  *   *** *   *  * **  **        ** *   *  ***  **      :
5mfd_G_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGN-EQKQAVKE: 296
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG   HHHHHHHHHHHHHHHTS H-HHHHHHHH:    
ExpBur          :bbbeeeeebbbbbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbebee-ebeebbee:    

queryA       419:CGIIEPLMNLLTAKDTKI: 436
                : *  * *  *      **:
5mfd_G_1     297:AGALEKLEQLQSHENEKI: 314
SecStr          :TTHHHHHHHGGG S HHH:    
ExpBur          :eebeeebeebeeeeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123