Protein Model on 5mff_D_1_C_1 (TEMPLATE: 5mff )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [279 aa] YIIIM5AII
2 b C 1 (C) polymer(polypeptide(L)) [279 aa] YIIIM5AII 149S 150G 151T(G) 152S(N) 192D(G) 193G 194S(N) 239N 266E(Q) 280D(S) 308P(Q) 348K(N) 349T(E) 350N(Q) 390D(N) 391F(E) 392K (identity: 29.4 %/40.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mff_D_1 identity=40.5%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mff_D_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHHTTSSS HHHH-HHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG SSSHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :beeebebbeeeeeeebb-ebbebbbebbeeeeeebeebbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbbbbeeebbebbbebbebeeee-:    
Contact         :                            bbbb                                       bbb                          

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mff_D_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbbbbebeeebbebbbeee--bbebbbebbebeeeebbebbbebbbbbbebeeebbbbbbeeebbeebbebbebeeeebbebbbebbb:    
Contact         :                  b b                          b             b                           b          

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEA: 397
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****:
5mff_D_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEA: 276
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG SSHHHHHHH:    
ExpBur          :bbbebeeebbbbbbeeebbeebbebbebebeebbebbbebbbbbbebeeebeebbeeebbeeebeebeeeeeeebeebb:    
Contact         :                             bbb                                       bbb                          


Input Residue Numbers for Focused Sites

ex) 2,15,123