Protein Model on 5mfg_A_1_B_1 (TEMPLATE: 5mfg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [282 aa] YIIIM5AII
2 b B 1 (B) polymer(polypeptide(L)) [269 aa] YIIIM5AII 325D(N) 328T(I) 329Q 332I 337L 341P(V) 344L 349T(E) 352Q(L) 353K(Q) 356T(L) 357W 359M(L) 360S 361N 362I 363T(A) 364A(S) 365G 370I(K) 372Q(A) 379V(L) 382L 383V(E) 386L(Q) 387S 389A(E) 393T(I) 394Q 396E 399W(E) 400A 403N(K) (identity: 42.4 %/39.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfg_A_1 identity=39.9%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfg_A_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHHTT S HHHHH-HHHHHHHHHHSS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHHT HHHHHHHTT S HH-:    
ExpBur          :eeebbeebebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbebbbeeebbeebeebbebeeee-:    

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfg_A_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :----bbebbbebbbbbbebbeebbebbbeee--bbebbeebbebeeeebbebbbebbbbbbebbeebbbbbbeeebbeebeebbebeeeebbebbbebbb:    

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
5mfg_A_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTTT GGG   SSTTHHHHHHHHHTTHHHHHHHHHHHHHHHHHT:    
ExpBur          :bbbbbbeebbebbeeeebeebbeebeebeeeebeebbebbeebbebeebebebbebeeebeeeeeeeeeebeeeeeeeeeeeeeeeee:    
Contact         :      b  bb  b    b   b  b    b  bb  bb bbbbbbb    b b      b  bb  bb b   bb b  bb  b               


Input Residue Numbers for Focused Sites

ex) 2,15,123