Protein Model on 5mfg_C_1_D_1 (TEMPLATE: 5mfg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [270 aa] YIIIM5AII
2 b D 1 (D) polymer(polypeptide(L)) [241 aa] YIIIM5AII 150G 151T(G) 154Q 155T(I) 157A 158V 161G(A) 162G 166A 167F(L) 178I 181Q(E) 184W 185A 188N 189I (identity: 68.8 %/41.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfg_C_1 identity=41.4%
queryA       144:LTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR--NKN: 241
                :*  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *         *    * ***     *  :
5mfg_C_1      28:LSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQ: 122
SecStr          :HHHHHHTTHHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HH-----HHHHHHHHHHHHHTS HHH:    
ExpBur          :eeeeeeeeeeeebeebeeeebeebeeebebeeeeebeebbeebbebbebbeebbbbbbeeebbebbeebbebeeee-----bbebbbebbbbbbebbeeb:    
Contact         :      bb  bb bb  bb   bb          b  b  bb  bb                                                      

queryA       242:PAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFP: 341
                :    ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  **  *  ** * *******    :
5mfg_C_1     123:IQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALV: 220
SecStr          :HHHHHHTT--HHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHH:    
ExpBur          :bbbbbeee--bbebbeebbebeeeebbebbbebbbbbbebbeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbebbeebbbbbbeeebbebbb:    

queryA       342:SLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                : **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
5mfg_C_1     221:QLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHTTT S HHHHHHHHHHHHHS  :    
ExpBur          :ebbebeeeebbebbbebbbbbbebbeebbebbbeebbeebbeebeebeeeebeebbeebeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123