Protein Model on 5mfg_D_1_E_1 (TEMPLATE: 5mfg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) D 1 (D) polymer(polypeptide(L)) [241 aa] YIIIM5AII
2 b E 1 (E) polymer(polypeptide(L)) [10 aa] (RR)4 315R(W) 357W 360S 361N 399W 402T(S) 403N (identity: 71.4 %/39.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfg_D_1 identity=39.1%
queryA       164:IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLH: 261
                : *     * **       *   *  **  *      **  **   *  **  *         *    * ***     *    * **     ** ** ** :
5mfg_D_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQLLS:  98
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHGGG S HH-----HHHHHHHHHHHHTTS HHH--HHHHHHHT HHHHHHGGG:    
ExpBur          :beebbeebebeeeeebbebbeebbeebeeeeeebeebbeeebbebbeebbebeeee-----bbebbbebbbbbbebeeeb--bbbbbeeebbebbbebbe:    

queryA       262:HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN: 361
                :      *    ** *    * ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *  ** *  **:
5mfg_D_1      99:SPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSN: 198
SecStr          : S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHH:    
ExpBur          :beeeebbebbbebbbbbbebbeebbebbbeeebbeebeebbebeeeebbebbbebbbbbbebbeebbbbbbeeebbebbbebbebeeeebbebbbebbbe:    
Contact         :                                                     b                                         b  bb

queryA       362:ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGG: 408
                :*  *   *** *   *  * **  **        ** **  *  ***:
5mfg_D_1     199:IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGG: 245
SecStr          :HHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTT  :    
ExpBur          :bbebbeebbebbeeeebeebbeebeebeeeebeebbeebeeebeeee:    
Contact         :                                     b  bb                                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123