Protein Model on 5mfh_A_1_E_1 (TEMPLATE: 5mfh )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [283 aa] YIIIM5AII
2 b E 1 (E) polymer(polypeptide(L)) [8 aa] (RR)5 146N(Q) 152S(N) 155T(I) 184W 188N 190A 191G(S) 192D(G) 193G 194S(N) 197R(I) 227R(Q) 231W 234S 235N 238R(S) 239N 242P(I) 270D(E) 273W 277Y(N) 280D(S) 281G (identity: 43.5 %/39.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfh_A_1 identity=39.9%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfh_A_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHGGG S HHHHH-HHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :eeebbeebebeeeeebb-ebbeebbebbeeeeeebeebbebebbebbbebbebeeeebbeebbebbbbbbebeeebbeebbeeebbeebbebbeeeeee-:    
Contact         :                         b     b  b                            b   b bbbbb  b                       

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfh_A_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbebbebeeebbbebbeee--bbebbbebbeeeeeebbebbbebbbbbbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbb:    
Contact         :      b   b  bb  bbbb  b                           b  b   b  bb                                     

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
5mfh_A_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHH :    
ExpBur          :bbbeeeeebbbebbeeebbebbbebbeeeeeebbbbbbebbbebbebeeebbebbeeeebeeebeebeebeeeebeebbeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123