Protein Model on 5mfi_A_1_B_1 (TEMPLATE: 5mfi )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [239 aa] YIII(Dq.V2)4CqI
2 b B 1 (B) polymer(polypeptide(L)) [240 aa] YIII(Dq.V2)4CqI 264D 266E(Q) 306E(S) 308P(E) 348K(S) 350N(E) 390D(S) 392K(E) 435K(E) (identity: 11.1 %/34.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfi_A_1 identity=34.9%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
5mfi_A_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 105
SecStr          :HHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHH  HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHH:    
ExpBur          :beebbeebebeeeeebbebbeebbebbeeeeeebeebbeeebbeebbebbeeeeeebbbbbbebbbbbbebeeebbeebbeeebbebbbebbeebeeebb:    
Contact         :           b b                                       b b                                       b b  

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : ** *   **  *   ***     *    **  *  *      *****  *  **   ***  *   *   **  **       *     ** **     :
5mfi_A_1     106:QEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIAS---: 201
SecStr          :HHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHTTS H-HHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHT---:    
ExpBur          :ebbbebbbbbbebeeebbeebbeeebbebbbebbeebeeebbeebbebbbbbbebee-ebbeebbeeebbebbbebbebebeebbebbbebbbbbbe---:    
Contact         :                                     b b                                          b                 

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  *  *      ** *     * **   ** * *      *   *:
5mfi_A_1     202:--GNNEQIQ-KLEEAGAEPALEKLQSSPNEEVQKNAQAALEALNS: 243
SecStr          :--S HHHHH-HHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHT :    
ExpBur          :--beeebbe-ebeeeebeebbeebeebeeeebeeebeebbebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123