Protein Model on 5mfl_B_1_N_1 (TEMPLATE: 5mfl )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [333 aa] (KR)5_GS10_YIIIM6AII
2 b N 1 (B) non-polymer(MG) MAGNESIUM ION 129G(N) 169S(Q) (identity: 0.0 %/40.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfl_B_1 identity=40.4%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfl_B_1      28:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 125
SecStr          :HHHHHHHTT S HHHHH-HHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :beebbeebebeeeeebb-ebbeebbeebeeeeeebeebbebebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbeebbebbeeeeee-:    
Contact         :        b                                       b                                                   

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfl_B_1     126:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 219
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHHT--HHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHHTHHHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbbbbbbbbbbeeebbbbbbeee--bbeebbebbeeeeeebbebbbbbbbbbbbbbeebbebbbeeebbeebbebbeeeeeebbbbbbbbbb:    

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH: 418
                :**  *  ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  **      :
5mfl_B_1     220:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE: 318
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHTTS S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHHTS H-HHHHHHHH:    
ExpBur          :bbbbbbeebbebbbeeebbeebbebbeeeeeebbebbbbbbbbbbbbbeebbbbbbeeebbebbbebbeeeeeebbebbbbbbbbbbbbbe-ebbebbee:    

queryA       419:CGIIEPLMNLLTAKDTKI: 436
                : *  * *  *      **:
5mfl_B_1     319:AGALEKLEQLQSHENEKI: 336
SecStr          :TTHHHHHHHGGG S HHH:    
ExpBur          :eebeeebeebeeeeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123