Protein Model on 5mfm_F_1_QA_1 (TEMPLATE: 5mfm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:6]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) F 1 (F) polymer(polypeptide(L)) [334 aa] YIIIM6AII_GS11_(KR)5
2 b QA 1 (F) non-polymer(EDO) 1,2-ETHANEDIOL 239N 282P(G) 283N (identity: 66.7 %/40.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfm_F_1 identity=40.4%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfm_F_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHGGG S HHHHH-HHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTT HHHHHHGGG S HH-:    
ExpBur          :eeebbeebebeeeeebb-ebbeebbeebeeeeeebeebbeeebbebbbebbeeeeeebbebbbebbbbbbbbeeebbebbbeeebbeebbebbeeeeee-:    

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfm_F_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbbbbbbbbbbbeebbbbbbeee--bbebbbebbeeeeeebbbbbbbbbbbbbbbbeebbbbbbeeebbeebbebbeeeeeebbebbbbbbb:    
Contact         :                    b                                          bb                                   

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH: 418
                :**  *  ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  **      :
5mfm_F_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKE: 296
SecStr          :HHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHTS H-HHHHHHHH:    
ExpBur          :bbbbbbeebbeebbeeebbeebbebbeeeeeebbebbbbbbbbbbbbeeebbbbbbeeebbeebbebbeeeeeebbbbbbebbbbbbebbe-ebbebbee:    

queryA       419:CGIIEPLMNLLTAKDTKI: 436
                : *  * *  *      **:
5mfm_F_1     297:AGALEKLEQLQSHENEKI: 314
SecStr          :TT HHHHHHGGG S HHH:    
ExpBur          :eebeeebeebeeeeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123