Protein Model on 5mfo_F_1_W_1 (TEMPLATE: 5mfo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:6]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) F 1 (F) polymer(polypeptide(L)) [201 aa] YIIIM3AIII
2 b W 1 (F) non-polymer(EDO) 1,2-ETHANEDIOL 255T(Q) (identity: 0.0 %/38.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfo_F_1 identity=38.8%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   * :
5mfo_F_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQIL: 105
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHH:    
ExpBur          :beebbeebebeeeeebbebbeebbebbeeeeeebeebbebebbebbeebbebeeeebbeebbebbbbbbeeeeebbbbbbeeebbebbeebbebeeeebb:    
Contact         :  b                                                                                                 

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI: 436
                : ** *  ***  *   *** *   *  * **  **        ** **  *  ***  **       *    *  *      **:
5mfo_F_1     106:QEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGAEPALEQLQSSPNEKI: 188
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHTTTT SSHHH:    
ExpBur          :ebbbebbbbbbebbeebbbbbbeeebbebbeebbebeeeebbbbbbebbbebbebbe-ebbebbeeeebeebbeebeebeeeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123