Protein Model on 5t94_B_1_A_1 (TEMPLATE: 5t94 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [422 aa] Importin subunit alpha :IMA1_YEAST
2 b A 1 (A) polymer(polypeptide(L)) [454 aa] Guanine nucleotide exchange factor SRM1 :RCC1_YEAST 89N(D) 90V(M) 91E(Q) 92N(E) 94L 95Q(S) 98Q(V) 99A(K) 101R 102K(Q) 105S 106R 107E 133C(P) 134S(E) 135P(M) 138F(L) 139E 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 234S 235N 238R 270D 273W 277Y 321V 322T 323G 324T(N) 325D 328T 357W 361N 364A 395K 396E 399W 435K(R) (identity: 73.1 %/49.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5t94_B_1 identity=49.6%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
5t94_B_1      92:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 191
SecStr          :HHHHHTSS HHHHHHHHHHHHHHHT SSS  HHHHHHTT HHHHHHTTSSSS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :beebbeeeeeeebbebbeebbeebeeeeeeebeebeeeebbebbbebbeeebeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebeb:    
Contact         :        bbbb bb  bb bb  bbb                         bbb  bb  b   b bbbbb  b                         

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
5t94_B_1     192:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 286
SecStr          :HHHHHHHHHHHH HHHHHHHHHTT HHHHHHGG-----G   HHHHHHHHHHHHHHS  STT   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHHSS:    
ExpBur          :bbbebbbbbbeeeeebbeebbeeebbebbbebb-----eeeeeebbebbbebbbbbbeeeeeebeeeebeebbebbbebbeeeeeebbbbbbebbbebbe:    
Contact         :b  b  bb  bb                                      b  bb  b                               b  b   b   

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
5t94_B_1     287:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 386
SecStr          :SSHHHHHHHHHTT HHHHHHTTS SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbebebbeebbebbeeeebebbbbbbebbbbbbebeeebbeebbeeebbebbeebbebeeeebeebbbebbbebbeeeeebbeebbeeebbb:    
Contact         :                                        bbbbb  b                            b   b  b                

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
5t94_B_1     387:PLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 486
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHHGGGTT THHHHHHHHTT HHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHTTTTT SS TTTHHHHHTT HHHH:    
ExpBur          :bbbebbeebeeebbbbbbebbbebbebbeeeeebbeebbeeebbebbbebbeebeeebbebbbebbeebbebbeeeeeeeeeeebebbeebeebebeebb:    
Contact         :              bb  b                                     b                                           

queryA       474:EALQNHENESVYKASLSLIEKYF: 496
                :   *  **   *      ** **:
5t94_B_1     487:FNCQQNENDKIYEKAYKIIETYF: 509
SecStr          :HTTSSS  HHHHHHHHHHHHHH :    
ExpBur          :eebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123