Protein Model on 5tbk_H_1_N_1 (TEMPLATE: 5tbk )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:8]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) H 1 (H) polymer(polypeptide(L)) [417 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b N 1 (O) polymer(polypeptide(L)) [418 aa] Regulator of chromosome condensation :RCC1_HUMAN 101R 105S 107E(D) 108K(R) 142W 146N 148A 149S 150G 155T 180E 181Q 184W 188N 191G 192D 224G(T) 227R 228N 231W 234S(V) 235N 238R 264D 273W 277Y 315R 319N 321V 322T 323G 325D 328T 357W 361N 364A 365G 396E 399W 403N 406S(I) 407G(S) (identity: 85.7 %/54.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5tbk_H_1 identity=54.5%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** *** :
5tbk_H_1      72:SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ: 171
SecStr          : SSTHHHHTTSS HHHHHHHHHHHHHHHHTTSS    S S STHHHHHHHHHH  S HHHHHHHHHHHHHHHTS HHHHHHHHTTT HHHHHHHTT S H:    
ExpBur          :eeeebeeebeeeeeeebeebbeebbeeeeeeeeeeeeeeebeebbeebbebbeeeebeebbebbbebbbebbeeeeeebeebbeeebbebbbebbebeee:    
Contact         :                        b   b bb                                 b   b bbb    b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** ** *:
5tbk_H_1     172:NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALS: 267
SecStr          :HHHHHHHHHHHHHHHH HHHHHHHHHT  HHHHHTT  ----TTS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :ebbebbbebbbbbbeebeebbeebbeeebbeebbeeee----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbbebbebbb:    
Contact         :   bb  b   b  bb                               b  bb  b  bb  b                         b        b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH: 376
                :****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * *   :
5tbk_H_1     268:YLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA: 367
SecStr          :HHHHH HHHHHHHHHTT HHHHGGGGG SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT GGGHHHHHH S HHHHHHHHHHHHHHTTS HHHHHHHHTT:    
ExpBur          :ebbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbeebbeeeeeebbebbbbbbbebbebeeebbeebbee:    
Contact         :b                                     b   b bbb b  b                            b   b  bb           

queryA       377:GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL: 476
                : ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* *** *:
5tbk_H_1     368:NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQL: 465
SecStr          :T HHHHHHHHHHS HHHHHHHHHHHHHHHHHS HHHHHHHHTTT HHHHHGGGGSS HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHHHH:    
ExpBur          :ebbeebbebbeeeeebbbbbbbebbbbbbeebeeebbeebbeeebbebbbebbeeeeeebbebbbebbbbbbeebee--eeeebbeebeeeebbebbeeb:    
Contact         :                   b  b   b  bb                                                                     

queryA       477:QNHENESVYKASLSLIEKYFS: 497
                :******  **     *   **:
5tbk_H_1     466:QNHENEDIYKLAYEIIDQFFS: 486
SecStr          : STT HHHHHHHHHHHHHH  :    
ExpBur          :eeeeeeebeeebeebbeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123