Protein Model on 5w4e_A_1_B_1 (TEMPLATE: 5w4e )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1,Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (A) polymer(polypeptide(L)) [10 aa] human DNA repair polymerase Tdt 105S 107E 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 228N 231W 235N 238R 270D 273W 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5w4e_A_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
5w4e_A_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebb:    
Contact         :                                 b b                              b   b   b bbbbb  b                

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
5w4e_A_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbeb:    
Contact         :         b  b  bb  bb                                   b  b   b  b                               b 

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
5w4e_A_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHHSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbe:    
Contact         : b   b                                                                                              

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
5w4e_A_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbebbeebebebbeebbeeebbebbbebbebeeeebbbbbbebbebbbebbeeeeeeeebbeebeeeebee:    

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
5w4e_A_1     453:KIEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHHGGG SSHHHHHHHHHHHHHH :    
ExpBur          :ebeebeeeeeeebbeebeebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123