Protein Model on 5x8n_A_1_B_1 (TEMPLATE: 5x8n )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [8 aa] Epstein-Barr nuclear antigen leader protein :EBNA5_EBVB9 104L 105S 106R 107E 110P 138F 142W 146N 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 234S 235N 238R 270D 277Y (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5x8n_A_1 identity=94.4%
queryA        73:TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 172
                :****** ******** * * ************************************* ******************************************:
5x8n_A_1       4:TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 103
SecStr          :  S  HHHHHHHHTT  HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT:    
ExpBur          :eeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbeebbebbe:    
Contact         :                               bbbb  b                           b   b   b  bbbb  b                 

queryA       173:SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC: 272
                :********************** ******* ** *********** * ************************* **************** ******* *:
5x8n_A_1     104:SPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSC: 203
SecStr          : S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHHH:    
ExpBur          :beeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebb:    
Contact         :        b  b   b  bb                                   b  b  bb  b                               b  

queryA       273:WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 372
                :************** **** ************ ************************ ******************************************:
5x8n_A_1     204:WAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 303
SecStr          :HHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :ebbbebbeeeeebbebbbeeebbebbbebbeeeeeebbbbbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebbee:    
Contact         :    b                                                                                               

queryA       373:VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 472
                :*********** ************* ** **************************** ******* **********************************:
5x8n_A_1     304:VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 403
SecStr          :HHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHHH:    
ExpBur          :bbeeebbeebbebbeeeebebbeebbebbbebbeebbbebbeebbeeebbebbbebbebebeebbebbbebbebbbebbeeeeeeeebbeebeeeebbee:    

queryA       473:IEALQNHENESVYKASLSLIEKYFS: 497
                :***** *********** *******:
5x8n_A_1     404:IEALQRHENESVYKASLNLIEKYFS: 428
SecStr          :HHHGGG SSHHHHHHHHHHHHHH  :    
ExpBur          :beebeeeeeeebeeebeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123